If you live in Kolkata, you already know how essential a kitchen chimney is in every modern home. With daily cooking, especially oily and spicy dishes, the chimney works hard to keep your kitchen clean and smoke-free. But like any appliance, it needs regular care. That’s where SS Fresh Chimney Service and Repair Kolkata comes in — your trusted partner for professional, affordable, and quick chimney service and repair in the city.
Why Chimney Servicing Is Important
A chimney might look fine from the outside, but inside it collects oil, soot, and grease that reduce its suction power. Ignoring maintenance can lead to:
- Reduced performance and higher noise
- Foul smell and smoke build-up in your kitchen
- Fire hazards from oil residue
- Expensive motor or PCB damage over time
Regular servicing ensures your chimney continues to perform efficiently, keeps your home safe, and saves money on big repairs later.
Our Expertise
At SS Fresh Chimney Service Kolkata, we handle all major brands — Elica, Faber, Glen, Hindware, Kutchina, and others. Whether it’s a wall-mounted, island, or auto-clean model, our experienced technicians know the exact maintenance and repair steps for each type.
We provide:
- Chimney Installation: Proper mounting and duct fitting to ensure smooth performance.
- Chimney Deep Cleaning: We remove oil, carbon, and sticky deposits using eco-friendly solutions.
- Motor and PCB Repair: Our experts fix motor noise, suction issues, and circuit problems efficiently.
- Filter and Duct Replacement: Replacement with genuine parts to restore airflow and safety.
- Annual Maintenance Contracts (AMC): Keep your chimney in perfect condition with scheduled services.
Why Choose SS Fresh for Chimney Service in Kolkata
There are many local service providers, but homeowners trust SS Fresh for a reason.
Here’s what makes us stand out:
- Trained Technicians: Every service expert is well-trained in handling all popular chimney brands.
- Transparent Pricing: No hidden charges — you get clear rates before we start the job.
- Doorstep Service: We provide same-day service anywhere in Kolkata.
- Use of Original Parts: We only use genuine parts from trusted suppliers.
- Customer Satisfaction: We believe in long-term relationships — most of our customers come through referrals.
Common Chimney Problems We Fix
- Chimney not turning on or making noise
- Suction not working properly
- Oil dripping from the filter
- Bad odor from the chimney
- Auto-clean feature not functioning
- Smoke or smell not being expelled properly
Our technicians diagnose these issues quickly and fix them on the spot in most cases.
Our Service Areas in Kolkata
We cover almost every major locality in and around the city including:
Salt Lake, New Town, Behala, Garia, Dum Dum, Howrah, Tollygunge, Ballygunge, and more.
Wherever you are in Kolkata, just search “chimney service near me” — you’ll find SS Fresh Chimney Service Kolkata ready to help.
Customer Satisfaction Is Our Priority
Every job is handled with care and professionalism. Our customers appreciate our punctuality, cleanliness, and clear communication. From booking to completion, we keep the process simple — just call, schedule, and get your chimney serviced without hassle.
Contact Us
📞 Call / WhatsApp: 9088810542
🌐 Website: ssfreshchimneyserviceandrepairkolkata.com
Get fast, reliable, and affordable chimney repair and cleaning service in Kolkata today.
Let your kitchen breathe fresh again — with SS Fresh Chimney Service Kolkata.